Recombinant Human AGTPBP1 Protein, GST-tagged

Cat.No. : AGTPBP1-445H
Product Overview : Human AGTPBP1 partial ORF ( NP_056054, 1087 a.a. - 1186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM, Jul 2002]
Molecular Mass : 36.74 kDa
AA Sequence : GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGTPBP1 ATP/GTP binding protein 1 [ Homo sapiens ]
Official Symbol AGTPBP1
Synonyms AGTPBP1; ATP/GTP binding protein 1; cytosolic carboxypeptidase 1; carboxypeptidase tubulin; KIAA1035; Nna1; soluble carboxypeptidase; tubulinyl Tyr carboxypeptidase; tyrosine carboxypeptidase; carboxypeptidase-tubulin; ATP/GTP-binding protein 1; tubulinyl-Tyr carboxypeptidase; nervous system nuclear protein induced by axotomy protein 1 homolog; CCP1; NNA1; DKFZp686M20191;
Gene ID 23287
mRNA Refseq NM_015239
Protein Refseq NP_056054
MIM 606830
UniProt ID Q9UPW5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AGTPBP1 Products

Required fields are marked with *

My Review for All AGTPBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon