Recombinant Human AGTPBP1 Protein, GST-tagged

• Cat.No.: AGTPBP1-445H
• Product Overview: Human AGTPBP1 partial ORF ( NP_056054, 1087 a.a. - 1186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM, Jul 2002]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGTPBP1 ATP/GTP binding protein 1 [ Homo sapiens ]
• Official Symbol: AGTPBP1
• Synonyms: AGTPBP1; ATP/GTP binding protein 1; cytosolic carboxypeptidase 1; carboxypeptidase tubulin; KIAA1035; Nna1; soluble carboxypeptidase; tubulinyl Tyr carboxypeptidase; tyrosine carboxypeptidase; carboxypeptidase-tubulin; ATP/GTP-binding protein 1; tubulinyl-Tyr carboxypeptidase; nervous system nuclear protein induced by axotomy protein 1 homolog; CCP1; NNA1; DKFZp686M20191
• Gene ID: 23287
• mRNA Refseq: NM_015239
• Protein Refseq: NP_056054
• MIM: 606830
• UniProt ID: Q9UPW5