Recombinant Human AGR3, His-tagged

• Cat.No.: AGR3-26657TH
• Product Overview: Recombinant full length Human AGR3 with N terminal His tag; 169 amino acids with tag, Predicted MWt 19.5 kDa.

Specification

• Description: Anterior gradient protein 3 homolog is a protein that in humans is encoded by the AGR3 gene.
• Protein length: 145 amino acids
• Conjugation: HIS
• Molecular Weight: 19.500kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
• Sequence Similarities: Belongs to the AGR family.

Gene Information

• Gene Name: AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: AGR3
• Synonyms: AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18
• Gene ID: 155465
• mRNA Refseq: NM_176813
• Protein Refseq: NP_789783
• MIM: 609482
• Uniprot ID: Q8TD06
• Chromosome Location: 7p21.1
• Function: alpha-dystroglycan binding