Recombinant Human AGFG2 Protein, GST-tagged
Cat.No. : | AGFG2-5030H |
Product Overview : | Human HRBL full-length ORF ( ENSP00000262935, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. The 3 UTR of this gene contains an insulin receptor substrate 3-like pseudogene. [provided by RefSeq |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWPDTFPRRLCQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGFG2 ArfGAP with FG repeats 2 [ Homo sapiens ] |
Official Symbol | AGFG2 |
Synonyms | AGFG2; ArfGAP with FG repeats 2; HIV 1 Rev binding protein like , HRBL; arf-GAP domain and FG repeat-containing protein 2; RABR; nucleoporin; HIV-1 Rev-binding protein-like protein; Rev/Rex activation domain binding protein-related; rev/Rex activation domain-binding protein related; arf-GAP domain and FG repeats-containing protein 2; HRBL; |
Gene ID | 3268 |
mRNA Refseq | NM_006076 |
Protein Refseq | NP_006067 |
MIM | 604019 |
UniProt ID | O95081 |
◆ Recombinant Proteins | ||
AGFG2-3613H | Recombinant Human AGFG2, His-tagged | +Inquiry |
AGFG2-5030H | Recombinant Human AGFG2 Protein, GST-tagged | +Inquiry |
AGFG2-3657HF | Recombinant Full Length Human AGFG2 Protein, GST-tagged | +Inquiry |
AGFG2-530H | Recombinant Human AGFG2 Protein, MYC/DDK-tagged | +Inquiry |
Agfg2-1553M | Recombinant Mouse Agfg2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGFG2-8981HCL | Recombinant Human AGFG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGFG2 Products
Required fields are marked with *
My Review for All AGFG2 Products
Required fields are marked with *
0
Inquiry Basket