Recombinant Full Length Human AGFG2 Protein, GST-tagged

• Cat.No.: AGFG2-3657HF
• Product Overview: Human HRBL full-length ORF ( ENSP00000262935, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 155 amino acids
• Description: This gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. The 3 UTR of this gene contains an insulin receptor substrate 3-like pseudogene. [provided by RefSeq
• Molecular Mass: 43.6 kDa
• AA Sequence: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWPDTFPRRLCQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGFG2 ArfGAP with FG repeats 2 [ Homo sapiens ]
• Official Symbol: AGFG2
• Synonyms: AGFG2; ArfGAP with FG repeats 2; HIV 1 Rev binding protein like , HRBL; arf-GAP domain and FG repeat-containing protein 2; RABR; nucleoporin; HIV-1 Rev-binding protein-like protein; Rev/Rex activation domain binding protein-related; rev/Rex activation domain-binding protein related; arf-GAP domain and FG repeats-containing protein 2; HRBL
• Gene ID: 3268
• mRNA Refseq: NM_006076
• Protein Refseq: NP_006067
• MIM: 604019
• UniProt ID: O95081