Recombinant Human ADRBK2 Protein, GST-tagged

• Cat.No.: ADRBK2-387H
• Product Overview: Human ADRBK2 partial ORF ( AAH36797, 48 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: AERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADRBK2 adrenergic, beta, receptor kinase 2 [ Homo sapiens ]
• Official Symbol: ADRBK2
• Synonyms: ADRBK2; adrenergic, beta, receptor kinase 2; beta-adrenergic receptor kinase 2; BARK2; GRK3; beta-ARK-2; G-protein-coupled receptor kinase 3
• Gene ID: 157
• mRNA Refseq: NM_005160
• Protein Refseq: NP_005151
• MIM: 109636
• UniProt ID: P35626