Recombinant Human ADORA3 Protein, GST-tagged

• Cat.No.: ADORA3-372H
• Product Overview: Human ADORA3 partial ORF ( AAH29831, 121 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein. [provided by RefSeq, Nov 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.18 kDa
• AA Sequence: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADORA3 adenosine A3 receptor [ Homo sapiens ]
• Official Symbol: ADORA3
• Synonyms: ADORA3; adenosine A3 receptor; adenosine receptor A3; AD026; A3AR; bA552M11.5; RP11-552M11.7
• Gene ID: 140
• mRNA Refseq: NM_000677
• Protein Refseq: NP_000668
• MIM: 600445
• UniProt ID: P33765