Recombinant Human ADIPOR1, GST-tagged

• Cat.No.: ADIPOR1-625H
• Product Overview: Human ADIPOR1 full-length ORF ( NP_057083.2, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14.
• Molecular Mass: 69 kDa
• AA Sequence: MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHH AMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLY YSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADIPOR1 adiponectin receptor 1 [ Homo sapiens (human) ]
• Official Symbol: ADIPOR1
• Synonyms: ADIPOR1; CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A; adiponectin receptor 1; progestin and adipoQ receptor family member I
• Gene ID: 51094
• mRNA Refseq: NM_015999
• Protein Refseq: NP_057083
• MIM: 607945
• UniProt ID: Q96A54
• Chromosome Location: 1q32.1
• Pathway: AMPK signaling; Adipocytokine signaling pathway
• Function: hormone binding; identical protein binding; protein heterodimerization activity