Recombinant Human ADI1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ADI1-5003H
• Product Overview: ADI1 MS Standard C13 and N15-labeled recombinant protein (NP_060739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.5 kDa
• AA Sequence: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ADI1 acireductone dioxygenase 1 [ Homo sapiens (human) ]
• Official Symbol: ADI1
• Synonyms: ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD
• Gene ID: 55256
• mRNA Refseq: NM_018269
• Protein Refseq: NP_060739
• MIM: 613400
• UniProt ID: Q9BV57