Recombinant Human ADI1 protein, T7-tagged

• Cat.No.: ADI1-165H
• Product Overview: Recombinant human ADI1 gene ( 179aa, Isoform-1 ) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 179 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNY SWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFT VDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: ADI1 acireductone dioxygenase 1 [ Homo sapiens ]
• Official Symbol: ADI1
• Synonyms: ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD
• Gene ID: 55256
• mRNA Refseq: NM_018269
• Protein Refseq: NP_060739
• MIM: 613400
• UniProt ID: Q9BV57
• Chromosome Location: 2p25.2
• Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Metabolism of polyamines, organism-specific biosystem; Methionine salvage pathway, organism-specific biosystem
• Function: acireductone dioxygenase [iron(II)-requiring] activity; metal ion binding; oxidoreductase activity; protein binding