Recombinant Human ADI1 Protein, GST-tagged
Cat.No. : | ADI1-357H |
Product Overview : | Human ADI1 full-length ORF ( NP_060739.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MVLAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADI1 acireductone dioxygenase 1 [ Homo sapiens ] |
Official Symbol | ADI1 |
Synonyms | ADI1; acireductone dioxygenase 1; 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase; APL1; ARD; FLJ10913; HMFT1638; membrane type 1 matrix metalloproteinase cytoplasmic tail binding protein 1; MTCBP 1; SIPL; submergence induced protein 2; submergence-induced protein-like factor; MT1-MMP cytoplasmic tail-binding protein-1; acireductone dioxygenase (Fe(2+)-requiring); acireductone dioxygenase (Ni(2+)-requiring); membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1; Fe-ARD; MTCBP1; Ni-ARD; |
Gene ID | 55256 |
mRNA Refseq | NM_018269 |
Protein Refseq | NP_060739 |
MIM | 613400 |
UniProt ID | Q9BV57 |
◆ Recombinant Proteins | ||
ADI1-7531H | Recombinant Human ADI1, His-tagged | +Inquiry |
ADI1-392H | Recombinant Human Acireductone Dioxygenase 1, T7-tagged | +Inquiry |
ADI1-10067Z | Recombinant Zebrafish ADI1 | +Inquiry |
ADI1-184R | Recombinant Rat ADI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADI1-1359M | Recombinant Mouse ADI1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADI1-9011HCL | Recombinant Human ADI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADI1 Products
Required fields are marked with *
My Review for All ADI1 Products
Required fields are marked with *
0
Inquiry Basket