Recombinant Human ADARB2 protein, GST-tagged
Cat.No. : | ADARB2-301224H |
Product Overview : | Recombinant Human ADARB2 (333-404 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln333-Ala404 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QAALQELFDIQMPGHAPGRARRTPMPQEFADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ADARB2 adenosine deaminase, RNA-specific, B2 [ Homo sapiens ] |
Official Symbol | ADARB2 |
Synonyms | ADARB2; adenosine deaminase, RNA-specific, B2; adenosine deaminase, RNA specific, B2 (RED2 homolog rat); double-stranded RNA-specific editase B2; ADAR3; hRED2; RED2; RED2 homolog (rat); RED2 homolog; homolog of rat BLUE; RNA-editing enzyme 2; RNA-editing deaminase 2; dsRNA adenosine deaminase B2; RNA-dependent adenosine deaminase 3; adenosine deaminase, RNA-specific, B2 (RED1 homolog rat); adenosine deaminase, RNA-specific, B2 (RED2 homolog rat); FLJ25034; FLJ36975; FLJ41340; |
Gene ID | 105 |
mRNA Refseq | NM_018702 |
Protein Refseq | NP_061172 |
MIM | 602065 |
UniProt ID | Q9NS39 |
◆ Recombinant Proteins | ||
ADARB2-512R | Recombinant Rat ADARB2 Protein | +Inquiry |
ADARB2-316H | Recombinant Human ADARB2 Protein, GST-tagged | +Inquiry |
ADARB2-329M | Recombinant Mouse ADARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AAK1-4205H | Recombinant Human AAK1 protein, His-tagged | +Inquiry |
ADARB2-168R | Recombinant Rat ADARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADARB2 Products
Required fields are marked with *
My Review for All ADARB2 Products
Required fields are marked with *
0
Inquiry Basket