Recombinant Human AAK1 protein, His-tagged
Cat.No. : | AAK1-4205H |
Product Overview : | Recombinant Human AAK1 protein(1-236 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-236 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSG |
Gene Name | AAK1 AP2 associated kinase 1 [ Homo sapiens ] |
Official Symbol | AAK1 |
Synonyms | AAK1; AP2 associated kinase 1; AP2-associated protein kinase 1; DKFZp686K16132; KIAA1048; adaptor-associated kinase 1; FLJ23712; FLJ25931; FLJ31060; FLJ42882; FLJ45252; MGC138170; MGC164568; MGC164570; DKFZp686F03202; |
Gene ID | 22848 |
mRNA Refseq | NM_014911 |
Protein Refseq | NP_055726 |
UniProt ID | Q2M2I8 |
◆ Recombinant Proteins | ||
ADARB2-329M | Recombinant Mouse ADARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADARB2-168R | Recombinant Rat ADARB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AAK1-4205H | Recombinant Human AAK1 protein, His-tagged | +Inquiry |
ADARB2-301224H | Recombinant Human ADARB2 protein, GST-tagged | +Inquiry |
ADARB2-1332M | Recombinant Mouse ADARB2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADARB2 Products
Required fields are marked with *
My Review for All ADARB2 Products
Required fields are marked with *
0
Inquiry Basket