Recombinant Human ADAR protein, His-tagged

• Cat.No.: ADAR-2894H
• Product Overview: Recombinant Human ADAR protein(P55265)(1-176aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 1-176aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.8 kDa
• AASequence: MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ADAR adenosine deaminase, RNA-specific [ Homo sapiens ]
• Official Symbol: ADAR
• Synonyms: ADAR; adenosine deaminase, RNA-specific; G1P1, IFI4, interferon induced protein 4; double-stranded RNA-specific adenosine deaminase; ADAR1; dsRNA adenosine deaminase; interferon-induced protein 4; interferon-inducible protein 4; adenosine deaminase acting on RNA 1-A; 136 kDa double-stranded RNA-binding protein; DSH; G1P1; IFI4; P136; DRADA; DSRAD; IFI-4; K88DSRBP
• Gene ID: 103
• mRNA Refseq: NM_001025107
• Protein Refseq: NP_001020278
• MIM: 146920
• UniProt ID: P55265