Recombinant Human ADAR protein, GST-tagged

• Cat.No.: ADAR-529H
• Product Overview: Recombinant Human ADAR(2 a.a. - 110 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.73 kDa
• AA Sequence: NPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFP VLLASSTRGRQVDIRGVPRGVHLGSQGLQRGFQH
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 2-110 a.a.

Gene Information

• Gene Name: ADAR adenosine deaminase, RNA-specific [ Homo sapiens ]
• Official Symbol: ADAR
• Synonyms: ADAR; adenosine deaminase, RNA-specific; G1P1, IFI4, interferon induced protein 4; double-stranded RNA-specific adenosine deaminase; ADAR1; dsRNA adenosine deaminase; interferon-induced protein 4; interferon-inducible protein 4; adenosine deaminase acting on RNA 1-A; 136 kDa double-stranded RNA-binding protein; DSH; G1P1; IFI4; P136; DRADA; DSRAD; IFI-4; K88DSRBP
• Gene ID: 103
• mRNA Refseq: NM_001111
• Protein Refseq: NP_001102
• MIM: 146920
• UniProt ID: P55265
• Chromosome Location: 1q21.3
• Pathway: C6 deamination of adenosine, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Formation of editosomes by ADAR proteins, organism-specific biosystem; Gene Expression, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: DNA binding; double-stranded RNA adenosine deaminase activity; double-stranded RNA adenosine deaminase activity; double-stranded RNA binding; hydrolase activity; metal ion binding