Recombinant Human ADAMTS7 protein, GST-tagged

• Cat.No.: ADAMTS7-17H
• Product Overview: Recombinant Human ADAMTS7(1589 a.a. - 1686 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.52 kDa
• Protein length: 1589 a.a. - 1686 a.a.
• AA Sequence: VQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ADAMTS7 ADAM metallopeptidase with thrombospondin type 1 motif, 7 [ Homo sapiens ]
• Official Symbol: ADAMTS7
• Synonyms: ADAMTS7; ADAM metallopeptidase with thrombospondin type 1 motif, 7; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; A disintegrin and metalloproteinase with thrombospondin motifs 7; a disintegrin and metalloprotease with thrombospondin motifs 7 preproprotein; ADAM TS7; COMPase; DKFZp434H204; a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; ADAM-TS7; ADAMTS-7; ADAM-TS 7
• Gene ID: 11173
• mRNA Refseq: NM_014272
• Protein Refseq: NP_055087
• MIM: 605009
• UniProt ID: Q9UKP4
• Chromosome Location: 15pter-qter
• Function: metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding