Recombinant Human ADAMTS5 Protein, GST-tagged

• Cat.No.: ADAMTS5-307H
• Product Overview: Human ADAMTS5 partial ORF ( NP_008969.1, 832 a.a. - 930 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs and functions as an aggrecanase that cleaves aggrecan, a major proteoglycan of cartilage, and may mediate cartilage destruction in osteoarthritis. [provided by RefSeq, Feb 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: VQILATDPTKPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS5 ADAM metallopeptidase with thrombospondin type 1 motif, 5 [ Homo sapiens ]
• Official Symbol: ADAMTS5
• Synonyms: ADAMTS5; ADAM metallopeptidase with thrombospondin type 1 motif, 5; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase 2); A disintegrin and metalloproteinase with thrombospondin motifs 5; ADAMTS11; ADMP 2; aggrecanase 2; aggrecanase-2; a disintegrin and metalloproteinase with thrombospondin motifs 11; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2); ADMP-2; ADAM-TS5; ADAMTS-5; ADAM-TS 5; ADAMTS-11; ADAM-TS 11
• Gene ID: 11096
• mRNA Refseq: NM_007038
• Protein Refseq: NP_008969
• MIM: 605007
• UniProt ID: Q9UNA0