Recombinant Human ADAMTS2 protein, GST-tagged

• Cat.No.: ADAMTS2-1955H
• Product Overview: Recombinant Human ADAMTS2 protein(1091-1211 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 1091-1211 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: KSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ]
• Official Symbol: ADAMTS2
• Synonyms: ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218
• Gene ID: 9509
• mRNA Refseq: NM_014244
• Protein Refseq: NP_055059
• MIM: 604539
• UniProt ID: O95450