Recombinant Human ADAMTS17 protein, GST-tagged
Cat.No. : | ADAMTS17-16H |
Product Overview : | Recombinant Human ADAMTS17 protein(583-720 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 583-720 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCGPYETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCHLVKGDFSHARGTALKDSGKG |
Gene Name | ADAMTS17 ADAM metallopeptidase with thrombospondin type 1 motif, 17 [ Homo sapiens ] |
Official Symbol | ADAMTS17 |
Synonyms | ADAMTS17; ADAM metallopeptidase with thrombospondin type 1 motif, 17; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; A disintegrin and metalloproteinase with thrombospondin motifs 17; FLJ16363; FLJ32769; ADAM-TS17; ADAMTS-17; ADAM-TS 17; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; |
Gene ID | 170691 |
mRNA Refseq | NM_139057 |
Protein Refseq | NP_620688 |
MIM | 607511 |
UniProt ID | Q8TE56 |
◆ Recombinant Proteins | ||
ADAMTS17-16H | Recombinant Human ADAMTS17 protein, GST-tagged | +Inquiry |
ADAMTS17-301H | Recombinant Human ADAMTS17 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS17 Products
Required fields are marked with *
My Review for All ADAMTS17 Products
Required fields are marked with *
0
Inquiry Basket