Recombinant Human ADAMTS17 Protein, GST-tagged

• Cat.No.: ADAMTS17-301H
• Product Overview: Human ADAMTS17 partial ORF ( NP_620688, 543 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature protein, which may promote breast cancer cell growth and survival. Mutations in this gene are associated with a Weill-Marchesani-like syndrome, which is characterized by lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature. [provided by RefSeq, May 2016]
• Molecular Mass: 37.62 kDa
• AA Sequence: DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS17 ADAM metallopeptidase with thrombospondin type 1 motif, 17 [ Homo sapiens ]
• Official Symbol: ADAMTS17
• Synonyms: ADAMTS17; ADAM metallopeptidase with thrombospondin type 1 motif, 17; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; A disintegrin and metalloproteinase with thrombospondin motifs 17; FLJ16363; FLJ32769; ADAM-TS17; ADAMTS-17; ADAM-TS 17; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17
• Gene ID: 170691
• mRNA Refseq: NM_139057
• Protein Refseq: NP_620688
• MIM: 607511
• UniProt ID: Q8TE56