Recombinant Human ADAMTS15 Protein, GST-tagged
Cat.No. : | ADAMTS15-300H |
Product Overview : | Human ADAMTS15 partial ORF ( NP_620686, 863 a.a. - 950 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme, which may play a role in versican processing during skeletal muscle development. This gene may function as a tumor suppressor in colorectal and breast cancers. [provided by RefSeq, May 2016] |
Molecular Mass : | 35.42 kDa |
AA Sequence : | AVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAMTS15 ADAM metallopeptidase with thrombospondin type 1 motif, 15 [ Homo sapiens ] |
Official Symbol | ADAMTS15 |
Synonyms | ADAMTS15; ADAM metallopeptidase with thrombospondin type 1 motif, 15; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15; A disintegrin and metalloproteinase with thrombospondin motifs 15; ADAM-TS15; ADAMTS-15; ADAM-TS 15; metalloprotease disintegrin 15 with thrombospondin domains; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15, preproprotein; MGC126403; |
Gene ID | 170689 |
mRNA Refseq | NM_139055 |
Protein Refseq | NP_620686 |
MIM | 607509 |
UniProt ID | Q8TE58 |
◆ Recombinant Proteins | ||
Adamts15-3011M | Recombinant Mouse Adamts15, His-tagged | +Inquiry |
ADAMTS15-324M | Recombinant Mouse ADAMTS15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAMTS15-528H | Active Recombinant Human ADAM Metallopeptidase With Thrombospondin type 1 Motif, 15, His-tagged | +Inquiry |
ADAMTS15-1312M | Recombinant Mouse ADAMTS15 Protein | +Inquiry |
ADAMTS15-300H | Recombinant Human ADAMTS15 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS15-9031HCL | Recombinant Human ADAMTS15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS15 Products
Required fields are marked with *
My Review for All ADAMTS15 Products
Required fields are marked with *
0
Inquiry Basket