Recombinant Human ADAMTS15 Protein, GST-tagged

• Cat.No.: ADAMTS15-300H
• Product Overview: Human ADAMTS15 partial ORF ( NP_620686, 863 a.a. - 950 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme, which may play a role in versican processing during skeletal muscle development. This gene may function as a tumor suppressor in colorectal and breast cancers. [provided by RefSeq, May 2016]
• Molecular Mass: 35.42 kDa
• AA Sequence: AVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAMTS15 ADAM metallopeptidase with thrombospondin type 1 motif, 15 [ Homo sapiens ]
• Official Symbol: ADAMTS15
• Synonyms: ADAMTS15; ADAM metallopeptidase with thrombospondin type 1 motif, 15; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15; A disintegrin and metalloproteinase with thrombospondin motifs 15; ADAM-TS15; ADAMTS-15; ADAM-TS 15; metalloprotease disintegrin 15 with thrombospondin domains; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 15, preproprotein; MGC126403
• Gene ID: 170689
• mRNA Refseq: NM_139055
• Protein Refseq: NP_620686
• MIM: 607509
• UniProt ID: Q8TE58