Recombinant Mouse ADAMTS13 Protein (904-1137 aa), His-Myc-tagged

• Cat.No.: ADAMTS13-2684M
• Product Overview: Recombinant Mouse ADAMTS13 Protein (904-1137 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 32.7 kDa
• Protein length: 904-1137 aa
• AA Sequence: WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Adamts13 a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13 [ Mus musculus ]
• Official Symbol: ADAMTS13
• Synonyms: ADAMTS13; ADAM-TS13; ADAMTS-13; ADAM-TS 13; vWF-cleaving protease; ADAMTS13 isoform IAP-b; Gm710; vWF-CP
• Gene ID: 279028
• mRNA Refseq: NM_001001322
• Protein Refseq: NP_001001322
• UniProt ID: Q769J6