Recombinant Human ADAMTS13

• Cat.No.: ADAMTS13-26136TH
• Product Overview: Recombinant fragment corresponding to amino acids 1328-1427 of Human ADAMTS13 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 1328-1427 a.a.
• Description: This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Plasma. Expressed primarily in liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
• Sequence Similarities: Contains 2 CUB domains.Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.Contains 8 TSP type-1 domains.

Gene Information

• Gene Name: ADAMTS13 ADAM metallopeptidase with thrombospondin type 1 motif, 13 [ Homo sapiens ]
• Official Symbol: ADAMTS13
• Synonyms: ADAMTS13; ADAM metallopeptidase with thrombospondin type 1 motif, 13; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13 , C9orf8; A disintegrin and metalloproteinase with thrombospondin motifs 13; DKFZp434C2322
• Gene ID: 11093
• mRNA Refseq: NM_139025
• Protein Refseq: NP_620594
• MIM: 604134
• Uniprot ID: Q76LX8
• Chromosome Location: 9q34
• Function: calcium ion binding; integrin binding; metalloendopeptidase activity; metallopeptidase activity; metallopeptidase activity