Recombinant Human ADAM9 Protein, GST-tagged

• Cat.No.: ADAM9-293H
• Product Overview: Human ADAM9 partial ORF ( NP_003807, 36 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM9 ADAM metallopeptidase domain 9 [ Homo sapiens ]
• Official Symbol: ADAM9
• Synonyms: ADAM9; ADAM metallopeptidase domain 9; a disintegrin and metalloproteinase domain 9 (meltrin gamma) , cone rod dystrophy 9 , CORD9; disintegrin and metalloproteinase domain-containing protein 9; KIAA0021; MCMP; MDC9; meltrin gamma; Mltng; cone rod dystrophy 9; myeloma cell metalloproteinase; cellular disintegrin-related protein; ADAM metallopeptidase domain 9 (meltrin gamma); metalloprotease/disintegrin/cysteine-rich protein 9; CORD9
• Gene ID: 8754
• mRNA Refseq: NM_003816
• Protein Refseq: NP_003807
• MIM: 602713
• UniProt ID: Q13443