Recombinant Human ADAM9 Protein, GST-tagged
Cat.No. : | ADAM9-293H |
Product Overview : | Human ADAM9 partial ORF ( NP_003807, 36 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Jul 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAM9 ADAM metallopeptidase domain 9 [ Homo sapiens ] |
Official Symbol | ADAM9 |
Synonyms | ADAM9; ADAM metallopeptidase domain 9; a disintegrin and metalloproteinase domain 9 (meltrin gamma) , cone rod dystrophy 9 , CORD9; disintegrin and metalloproteinase domain-containing protein 9; KIAA0021; MCMP; MDC9; meltrin gamma; Mltng; cone rod dystrophy 9; myeloma cell metalloproteinase; cellular disintegrin-related protein; ADAM metallopeptidase domain 9 (meltrin gamma); metalloprotease/disintegrin/cysteine-rich protein 9; CORD9; |
Gene ID | 8754 |
mRNA Refseq | NM_003816 |
Protein Refseq | NP_003807 |
MIM | 602713 |
UniProt ID | Q13443 |
◆ Recombinant Proteins | ||
ADAM9-3047C | Recombinant Chicken ADAM9 | +Inquiry |
ADAM9-1900C | Recombinant Cynomolgus ADAM9 protein, His-tagged | +Inquiry |
ADAM9-293H | Recombinant Human ADAM9 Protein, GST-tagged | +Inquiry |
ADAM9-1386Z | Recombinant Zebrafish ADAM9 | +Inquiry |
ADAM9-2422H | Recombinant Human ADAM9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM9-1750MCL | Recombinant Mouse ADAM9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM9 Products
Required fields are marked with *
My Review for All ADAM9 Products
Required fields are marked with *
0
Inquiry Basket