Recombinant Human ADAM2 Protein, GST-tagged
Cat.No. : | ADAM2-280H |
Product Overview : | Human ADAM2 partial ORF ( NP_001455, 376 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ] |
Official Symbol | ADAM2 |
Synonyms | ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30; PH-30; ADAM 2; PH30-beta; fertilin beta; fertilin subunit beta; FTNB; CRYN1; CRYN2; PH-30b; |
Gene ID | 2515 |
mRNA Refseq | NM_001464 |
Protein Refseq | NP_001455 |
MIM | 601533 |
UniProt ID | Q99965 |
◆ Recombinant Proteins | ||
ADAM2-280H | Recombinant Human ADAM2 Protein, GST-tagged | +Inquiry |
ADAM2-276C | Recombinant Cynomolgus ADAM2 Protein, His-tagged | +Inquiry |
ADAM2-26C | Recombinant Cynomolgus Monkey ADAM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM2-871HF | Recombinant Full Length Human ADAM2 Protein, GST-tagged | +Inquiry |
ADAM2-503R | Recombinant Rat ADAM2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM2-22HCL | Recombinant Human ADAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM2 Products
Required fields are marked with *
My Review for All ADAM2 Products
Required fields are marked with *
0
Inquiry Basket