Recombinant Human ADAM2 Protein, GST-tagged

• Cat.No.: ADAM2-280H
• Product Overview: Human ADAM2 partial ORF ( NP_001455, 376 a.a. - 475 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ]
• Official Symbol: ADAM2
• Synonyms: ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30; PH-30; ADAM 2; PH30-beta; fertilin beta; fertilin subunit beta; FTNB; CRYN1; CRYN2; PH-30b
• Gene ID: 2515
• mRNA Refseq: NM_001464
• Protein Refseq: NP_001455
• MIM: 601533
• UniProt ID: Q99965