Recombinant Human ADAM2

Cat.No. : ADAM2-26137TH
Product Overview : Recombinant fragment of Human ADAM2 with N-terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
Sequence Similarities : Contains 1 disintegrin domain.Contains 1 EGF-like domain.Contains 1 peptidase M12B domain.
Gene Name ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ]
Official Symbol ADAM2
Synonyms ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30;
Gene ID 2515
mRNA Refseq NM_001464
Protein Refseq NP_001455
MIM 601533
Uniprot ID Q99965
Chromosome Location 8p11.2
Function integrin binding; metalloendopeptidase activity; metallopeptidase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADAM2 Products

Required fields are marked with *

My Review for All ADAM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon