Recombinant Human ADAM2

• Cat.No.: ADAM2-26137TH
• Product Overview: Recombinant fragment of Human ADAM2 with N-terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
• Sequence Similarities: Contains 1 disintegrin domain.Contains 1 EGF-like domain.Contains 1 peptidase M12B domain.

Gene Information

• Gene Name: ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ]
• Official Symbol: ADAM2
• Synonyms: ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30
• Gene ID: 2515
• mRNA Refseq: NM_001464
• Protein Refseq: NP_001455
• MIM: 601533
• Uniprot ID: Q99965
• Chromosome Location: 8p11.2
• Function: integrin binding; metalloendopeptidase activity; metallopeptidase activity; zinc ion binding