Recombinant Human ADAM17
Cat.No. : | ADAM17-26135TH |
Product Overview : | Recombinant fragment (amino acids 215-314) of Human ADAM17 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. Expressed at highest levels in adult heart, placenta, skeletal muscle, pancreas, spleen, thymus, prostate, testes, ovary and small intestine, and in fetal brain, lung, liver and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV |
Sequence Similarities : | Contains 1 disintegrin domain.Contains 1 peptidase M12B domain. |
Gene Name | ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens ] |
Official Symbol | ADAM17 |
Synonyms | ADAM17; ADAM metallopeptidase domain 17; TACE, tumor necrosis factor, alpha, converting enzyme; disintegrin and metalloproteinase domain-containing protein 17; CD156B; cSVP; |
Gene ID | 6868 |
mRNA Refseq | NM_003183 |
Protein Refseq | NP_003174 |
MIM | 603639 |
Uniprot ID | P78536 |
Chromosome Location | 2p25 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Epithelial cell signaling in Helicobacter pylori infection, organism-specific biosystem; |
Function | PDZ domain binding; SH3 domain binding; integrin binding; interleukin-6 receptor binding; metal ion binding; |
◆ Recombinant Proteins | ||
ADAM17-1867C | Recombinant Chicken ADAM17 | +Inquiry |
Adam17-522M | Recombinant Mouse Adam17 protein, His-tagged | +Inquiry |
ADAM17-278H | Recombinant Human ADAM17 Protein, GST-tagged | +Inquiry |
Adam17-308M | Recombinant Mouse Adam17 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM17-157R | Recombinant Rat ADAM17 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM17-1198RCL | Recombinant Rat ADAM17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM17 Products
Required fields are marked with *
My Review for All ADAM17 Products
Required fields are marked with *
0
Inquiry Basket