Recombinant Human ADAM17

• Cat.No.: ADAM17-26135TH
• Product Overview: Recombinant fragment (amino acids 215-314) of Human ADAM17 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biologic processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene functions as a tumor necrosis factor-alpha converting enzyme; binds mitotic arrest deficient 2 protein; and also plays a prominent role in the activation of the Notch signaling pathway.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed. Expressed at highest levels in adult heart, placenta, skeletal muscle, pancreas, spleen, thymus, prostate, testes, ovary and small intestine, and in fetal brain, lung, liver and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV
• Sequence Similarities: Contains 1 disintegrin domain.Contains 1 peptidase M12B domain.

Gene Information

• Gene Name: ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens ]
• Official Symbol: ADAM17
• Synonyms: ADAM17; ADAM metallopeptidase domain 17; TACE, tumor necrosis factor, alpha, converting enzyme; disintegrin and metalloproteinase domain-containing protein 17; CD156B; cSVP
• Gene ID: 6868
• mRNA Refseq: NM_003183
• Protein Refseq: NP_003174
• MIM: 603639
• Uniprot ID: P78536
• Chromosome Location: 2p25
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Epithelial cell signaling in Helicobacter pylori infection, organism-specific biosystem
• Function: PDZ domain binding; SH3 domain binding; integrin binding; interleukin-6 receptor binding; metal ion binding