Recombinant Human ADAM11 Protein, GST-tagged

• Cat.No.: ADAM11-273H
• Product Overview: Human ADAM11 partial ORF ( NP_002381, 230 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded preproprotein is proteolytically processed to generate the mature protease. This gene represents a candidate tumor suppressor gene for human breast cancer based on its location within a minimal region of chromosome 17q21 previously defined by tumor deletion mapping. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.18 kDa
• AA Sequence: GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAM11 ADAM metallopeptidase domain 11 [ Homo sapiens ]
• Official Symbol: ADAM11
• Synonyms: ADAM11; ADAM metallopeptidase domain 11; a disintegrin and metalloproteinase domain 11 , MDC; disintegrin and metalloproteinase domain-containing protein 11; metalloproteinase like; disintegrin like; cysteine rich protein; ADAM 11; MDC
• Gene ID: 4185
• mRNA Refseq: NM_002390
• Protein Refseq: NP_002381
• MIM: 155120
• UniProt ID: O75078