Recombinant Human ACVR2B protein, His-B2M-tagged

• Cat.No.: ACVR2B-4440H
• Product Overview: Recombinant Human ACVR2B protein(Q13705)(19-137aa), fused to N-terminal His-B2M tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 19-137aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.7
• AA Sequence: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLT
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ACVR2B activin A receptor, type IIB [ Homo sapiens ]
• Official Symbol: ACVR2B
• Synonyms: ACVR2B; activin A receptor, type IIB; activin receptor type-2B; ActR IIB; HTX4; ACTRIIB; ActR-IIB
• Gene ID: 93
• mRNA Refseq: NM_001106
• Protein Refseq: NP_001097
• MIM: 602730
• UniProt ID: Q13705