Recombinant Full Length Human ACVR2B Protein, C-Flag-tagged
Cat.No. : | ACVR2B-1503HFL |
Product Overview : | Recombinant Full Length Human ACVR2B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-512aa |
Description : | Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTI ELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLA YSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLM NDFVAVKIFPLQDKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGN IITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGK PPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTS DCLVSLVTSVTNVDLPPKESSITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | ACVR2B activin A receptor type 2B [ Homo sapiens (human) ] |
Official Symbol | ACVR2B |
Synonyms | HTX4; ACTRIIB; ActR-IIB |
Gene ID | 93 |
mRNA Refseq | NM_001106.4 |
Protein Refseq | NP_001097.2 |
MIM | 602730 |
UniProt ID | Q13705 |
◆ Recombinant Proteins | ||
ACVR2B-198H | Recombinant Human Activin ACVR2B protein, His-tagged | +Inquiry |
ACVR2B-2675H | Active Recombinant Human ACVR2B protein, hFc&His-tagged | +Inquiry |
Acvr2b-296R | Recombinant Rat Acvr2b Protein, His-tagged | +Inquiry |
RFL-33848XF | Recombinant Full Length Xenopus Laevis Activin Receptor Type-2B(Acvr2B) Protein, His-Tagged | +Inquiry |
ACVR2B-084H | Recombinant Human ACVR2B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR2B-2724HCL | Recombinant Human ACVR2B cell lysate | +Inquiry |
ACVR2B-734CCL | Recombinant Cynomolgus ACVR2B cell lysate | +Inquiry |
ACVR2B-2540MCL | Recombinant Mouse ACVR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR2B Products
Required fields are marked with *
My Review for All ACVR2B Products
Required fields are marked with *
0
Inquiry Basket