Recombinant Human ACTR3B protein, GST-tagged
Cat.No. : | ACTR3B-8422H |
Product Overview : | Recombinant Human ACTR3B protein(156-418 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 156-418 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | RQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS |
Gene Name | ACTR3B ARP3 actin-related protein 3 homolog B (yeast) [ Homo sapiens ] |
Official Symbol | ACTR3B |
Synonyms | ACTR3B; ARP3 actin-related protein 3 homolog B (yeast); actin-related protein 3B; ARP3beta; ARP11; ARP3-beta; actin-like protein 3B; actin-related protein ARP4; actin-related protein Arp11; actin-related protein 3-beta; ARP3BETA; DKFZp686O24114; |
Gene ID | 57180 |
mRNA Refseq | NM_001040135 |
Protein Refseq | NP_001035225 |
UniProt ID | Q9P1U1 |
◆ Recombinant Proteins | ||
ALDOA-316H | Recombinant Human ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDOA-2138HFL | Recombinant Full Length Human ALDOA Protein, C-Flag-tagged | +Inquiry |
Aldoa-1520M | Recombinant Mouse Aldoa protein, His-tagged | +Inquiry |
ALDOA-281R | Recombinant Rat ALDOA Protein, His (Fc)-Avi-tagged | +Inquiry |
ALDOA-1518H | Recombinant Human ALDOA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDOA-8913HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
ALDOA-8912HCL | Recombinant Human ALDOA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALDOA Products
Required fields are marked with *
My Review for All ALDOA Products
Required fields are marked with *
0
Inquiry Basket