Recombinant Human ACTR3B protein, GST-tagged

• Cat.No.: ACTR3B-8422H
• Product Overview: Recombinant Human ACTR3B protein(156-418 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 156-418 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: RQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ACTR3B ARP3 actin-related protein 3 homolog B (yeast) [ Homo sapiens ]
• Official Symbol: ACTR3B
• Synonyms: ACTR3B; ARP3 actin-related protein 3 homolog B (yeast); actin-related protein 3B; ARP3beta; ARP11; ARP3-beta; actin-like protein 3B; actin-related protein ARP4; actin-related protein Arp11; actin-related protein 3-beta; ARP3BETA; DKFZp686O24114
• Gene ID: 57180
• mRNA Refseq: NM_001040135
• Protein Refseq: NP_001035225
• UniProt ID: Q9P1U1