Recombinant Human ACTL8 Protein, GST-tagged

• Cat.No.: ACTL8-227H
• Product Overview: Human ACTL8 full-length ORF ( NP_110439.1, 1 a.a. - 366 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ACTL8 (Actin Like 8) is a Protein Coding gene. An important paralog of this gene is ACTR2.
• Molecular Mass: 67.8 kDa
• AA Sequence: MASRTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACTL8 actin-like 8 [ Homo sapiens ]
• Official Symbol: ACTL8
• Synonyms: ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein
• Gene ID: 81569
• mRNA Refseq: NM_030812
• Protein Refseq: NP_110439
• UniProt ID: Q9H568