Recombinant Human ACTL8 Protein (1-366 aa), His-tagged

Cat.No. : ACTL8-2660H
Product Overview : Recombinant Human ACTL8 Protein (1-366 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Yeast
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 43.9 kDa
Protein length : 1-366 aa
AA Sequence : MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name ACTL8 actin-like 8 [ Homo sapiens ]
Official Symbol ACTL8
Synonyms ACTL8; actin-like 8; actin-like protein 8; cancer/testis antigen 57; CT57; actin like protein;
Gene ID 81569
mRNA Refseq NM_030812
Protein Refseq NP_110439
UniProt ID Q9H568

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACTL8 Products

Required fields are marked with *

My Review for All ACTL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon