Recombinant Human ACTL6A protein, T7-tagged

• Cat.No.: ACTL6A-139H
• Product Overview: Recombinant human ACTL6A protein fused with 15aa (T7) at N-terminal, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQENGRGEFSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKG KQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKL TELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQ EMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVH YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFT DRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for studying SWI/SNF-like BAF complex in vitro.2. Active recombinant protein, may be used for ELISA based DNA / protein binding assay.3. As specific protein substrate for kinase assay.4. As immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: ACTL6A actin-like 6A [ Homo sapiens ]
• Official Symbol: ACTL6A
• Synonyms: ACTL6A; actin-like 6A; actin-like protein 6A; actin related protein 4; Actl6; Arp4; BAF complex 53 kDa subunit; BAF53A; Baf53a; BRG1 associated factor; ACTL6; ARPN-BETA
• Gene ID: 86
• mRNA Refseq: NM_004301
• Protein Refseq: NP_004292
• MIM: 604958
• UniProt ID: O96019
• Chromosome Location: 3q26.33
• Pathway: C-MYC pathway, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem
• Function: ATP binding; chromatin binding; protein binding; transcription coactivator activity