Recombinant Human ACTC1 protein, GST-tagged

Cat.No. : ACTC1-244H
Product Overview : Recombinant Human ACTC1 protein(NP_005150)(1-50 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-50 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name ACTC1 actin, alpha, cardiac muscle 1 [ Homo sapiens ]
Official Symbol ACTC1
Synonyms ACTC1; actin, alpha, cardiac muscle 1; ACTC, actin, alpha, cardiac muscle; actin, alpha cardiac muscle 1; CMD1R; alpha-cardiac actin; ACTC; ASD5; CMH11; LVNC4;
Gene ID 70
mRNA Refseq NM_005159
Protein Refseq NP_005150
MIM 102540
UniProt ID P68032

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACTC1 Products

Required fields are marked with *

My Review for All ACTC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon