Recombinant Human ACSS1 Protein, GST-tagged

• Cat.No.: ACSS1-208H
• Product Overview: Human ACSS1 full-length ORF (BAC03530.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a mitochondrial acetyl-CoA synthetase enzyme. A similar protein in mice plays an important role in the tricarboxylic acid cycle by catalyzing the conversion of acetate to acetyl CoA. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.7 kDa
• AA Sequence: MKLKCIFGFATKETSCYNVTNIGFKSPSDFWQSVHSTLPRELAPCLVFNTSPNLALFSAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACSS1 acyl-CoA synthetase short-chain family member 1 [ Homo sapiens ]
• Official Symbol: ACSS1
• Synonyms: ACSS1; acyl-CoA synthetase short-chain family member 1; ACAS2L, acetyl Coenzyme A synthetase 2 (AMP forming) like; acetyl-coenzyme A synthetase 2-like, mitochondrial; AceCS2L; dJ568C11.3; MGC33843; acetate--CoA ligase 2; ACAS2L; ACECS1; FLJ45659
• Gene ID: 84532
• mRNA Refseq: NM_001252675
• Protein Refseq: NP_001239604
• MIM: 614355
• UniProt ID: Q9NUB1