Recombinant Human ACP1, His-tagged

Cat.No. : ACP1-26291TH
Product Overview : Recombinant fragment, corresponding to amino acids 4-158 of Human Acid Phosphatase with a N terminal His tag; 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 4-158 a.a.
Description : The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVD SAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKE DFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGS YDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Gene Name ACP1 acid phosphatase 1, soluble [ Homo sapiens ]
Official Symbol ACP1
Synonyms ACP1; acid phosphatase 1, soluble; low molecular weight phosphotyrosine protein phosphatase;
Gene ID 52
mRNA Refseq NM_001040649
Protein Refseq NP_001035739
MIM 171500
Uniprot ID P24666
Chromosome Location 2p25
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; EPHA2 forward signaling, organism-specific biosystem; PDGFR-beta signaling pathway, organism-specific biosystem; Riboflavin metabolism, organism-specific biosystem;
Function acid phosphatase activity; hydrolase activity; non-membrane spanning protein tyrosine phosphatase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACP1 Products

Required fields are marked with *

My Review for All ACP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon