Recombinant Human ACIN1 Protein, GST-Tagged

• Cat.No.: ACIN1-159H
• Product Overview: Human ACIN1 partial ORF ( NP_055792, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Apoptosis is defined by several morphologic nuclear changes, including chromatin condensation and nuclear fragmentation. This gene encodes a nuclear protein that induces apoptotic chromatin condensation after activation by caspase-3, without inducing DNA fragmentation. This protein has also been shown to be a component of a splicing-dependent multiprotein exon junction complex (EJC) that is deposited at splice junctions on mRNAs, as a consequence of pre-mRNA splicing. It may thus be involved in mRNA metabolism associated with splicing. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]
• Molecular Mass: 37.84 kDa
• AA Sequence: MWRRKHPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACIN1 apoptotic chromatin condensation inducer 1 [ Homo sapiens ]
• Official Symbol: ACIN1
• Synonyms: ACIN1; apoptotic chromatin condensation inducer 1; ACINUS, apoptotic chromatin condensation inducer in the nucleus; apoptotic chromatin condensation inducer in the nucleus; fSAP152; functional spliceosome associated protein 152; KIAA0670; functional spliceosome-associated protein 152; ACN; ACINUS; DKFZp667N107
• Gene ID: 22985
• mRNA Refseq: NM_001164814
• Protein Refseq: NP_001158286
• MIM: 604562
• UniProt ID: Q9UKV3