Recombinant Human ABL1 protein, His-tagged

• Cat.No.: ABL1-2962H
• Product Overview: Recombinant Human ABL1 protein(801-900 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 801-900 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP

Gene Information

• Gene Name: ABL1 c-abl oncogene 1, non-receptor tyrosine kinase [ Homo sapiens ]
• Official Symbol: ABL1
• Synonyms: ABL1; c-abl oncogene 1, non-receptor tyrosine kinase; ABL, c abl oncogene 1, receptor tyrosine kinase , v abl Abelson murine leukemia viral oncogene homolog 1; tyrosine-protein kinase ABL1; c ABL; JTK7; p150; proto-oncogene c-Abl; bcr/c-abl oncogene protein; Abelson tyrosine-protein kinase 1; c-abl oncogene 1, receptor tyrosine kinase; proto-oncogene tyrosine-protein kinase ABL1; v-abl Abelson murine leukemia viral oncogene homolog 1; ABL; c-ABL; v-abl; bcr/abl
• Gene ID: 25
• mRNA Refseq: NM_005157
• Protein Refseq: NP_005148
• MIM: 189980
• UniProt ID: P00519