Recombinant Human ABL1 protein, His-tagged
Cat.No. : | ABL1-2962H |
Product Overview : | Recombinant Human ABL1 protein(801-900 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 28, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 801-900 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP |
Gene Name | ABL1 c-abl oncogene 1, non-receptor tyrosine kinase [ Homo sapiens ] |
Official Symbol | ABL1 |
Synonyms | ABL1; c-abl oncogene 1, non-receptor tyrosine kinase; ABL, c abl oncogene 1, receptor tyrosine kinase , v abl Abelson murine leukemia viral oncogene homolog 1; tyrosine-protein kinase ABL1; c ABL; JTK7; p150; proto-oncogene c-Abl; bcr/c-abl oncogene protein; Abelson tyrosine-protein kinase 1; c-abl oncogene 1, receptor tyrosine kinase; proto-oncogene tyrosine-protein kinase ABL1; v-abl Abelson murine leukemia viral oncogene homolog 1; ABL; c-ABL; v-abl; bcr/abl; |
Gene ID | 25 |
mRNA Refseq | NM_005157 |
Protein Refseq | NP_005148 |
MIM | 189980 |
UniProt ID | P00519 |
◆ Recombinant Proteins | ||
ACIN1-159H | Recombinant Human ACIN1 Protein, GST-Tagged | +Inquiry |
ABL1-2962H | Recombinant Human ABL1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACIN1 Products
Required fields are marked with *
My Review for All ACIN1 Products
Required fields are marked with *
0
Inquiry Basket