Recombinant Human ACD Protein, GST-Tagged

• Cat.No.: ACD-154H
• Product Overview: Human ACD full-length ORF ( AAH16904, 1 a.a. - 544 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. [provided by RefSeq, Jul 2008]
• Molecular Mass: 61.2 kDa
• AA Sequence: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACD adrenocortical dysplasia homolog (mouse) [ Homo sapiens ]
• Official Symbol: ACD
• Synonyms: ACD; adrenocortical dysplasia homolog (mouse); adrenocortical dysplasia protein homolog; Pip1; POT1 and TIN2 organizing protein; Ptop; TIN2 interacting protein 1; Tint1; Tpp1; POT1 and TIN2-interacting protein; PIP1; PTOP; TPP1; TINT1
• Gene ID: 65057
• mRNA Refseq: NM_001082486
• Protein Refseq: NP_001075955
• MIM: 609377
• UniProt ID: Q96AP0