Recombinant Human ACAP1 protein, GST-tagged

• Cat.No.: ACAP1-7342H
• Product Overview: Recombinant Human ACAP1 protein(163-270 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 163-270 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG

Gene Information

• Gene Name: ACAP1 ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 [ Homo sapiens ]
• Official Symbol: ACAP1
• Synonyms: ACAP1; ArfGAP with coiled-coil, ankyrin repeat and PH domains 1; centaurin, beta 1 , CENTB1; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1; KIAA0050; cnt-b1; centaurin-beta-1; centaurin, beta 1; Arf GAP with coiled coil, ANK repeat and PH domains 1; CENTB1
• Gene ID: 9744
• mRNA Refseq: NM_014716
• Protein Refseq: NP_055531
• MIM: 607763
• UniProt ID: Q15027