Recombinant Human ACAP1 protein, GST-tagged
Cat.No. : | ACAP1-7342H |
Product Overview : | Recombinant Human ACAP1 protein(163-270 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 163-270 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG |
Gene Name | ACAP1 ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 [ Homo sapiens ] |
Official Symbol | ACAP1 |
Synonyms | ACAP1; ArfGAP with coiled-coil, ankyrin repeat and PH domains 1; centaurin, beta 1 , CENTB1; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1; KIAA0050; cnt-b1; centaurin-beta-1; centaurin, beta 1; Arf GAP with coiled coil, ANK repeat and PH domains 1; CENTB1; |
Gene ID | 9744 |
mRNA Refseq | NM_014716 |
Protein Refseq | NP_055531 |
MIM | 607763 |
UniProt ID | Q15027 |
◆ Recombinant Proteins | ||
AHSA2-27131TH | Recombinant Human AHSA2, His-tagged | +Inquiry |
AHSA2-407M | Recombinant Mouse AHSA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AHSA2-468H | Recombinant Human AHSA2 Protein, GST-tagged | +Inquiry |
AHSA2-9500H | Recombinant Human AHSA2, His-tagged | +Inquiry |
ACAP1-7342H | Recombinant Human ACAP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSA2-8960HCL | Recombinant Human AHSA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHSA2 Products
Required fields are marked with *
My Review for All AHSA2 Products
Required fields are marked with *
0
Inquiry Basket