Recombinant Human AHSA2 Protein, GST-tagged

• Cat.No.: AHSA2-468H
• Product Overview: Human AHSA2 full-length ORF ( NP_689605.1, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AHSA2 (Activator Of HSP90 ATPase Homolog 2) is a Protein Coding gene. GO annotations related to this gene include chaperone binding and ATPase activator activity. An important paralog of this gene is AHSA1.
• Molecular Mass: 42.1 kDa
• AA Sequence: MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLTPLNG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AHSA2 AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) [ Homo sapiens ]
• Official Symbol: AHSA2
• Synonyms: AHSA2; AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast); activator of 90 kDa heat shock protein ATPase homolog 2; DKFZp564C236; Hch1; FLJ34679; FLJ41715
• Gene ID: 130872
• mRNA Refseq: NM_152392
• Protein Refseq: NP_689605
• UniProt ID: Q719I0