Recombinant Human ACAN Protein, GST-tagged

Cat.No. : ACAN-420H
Product Overview : Human AGC1 partial ORF ( NP_037359, 56 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : PMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ACAN aggrecan [ Homo sapiens ]
Official Symbol ACAN
Synonyms ACAN; aggrecan; AGC1, aggrecan 1, chondroitin sulfate proteoglycan 1, CSPG1, MSK16; aggrecan core protein; aggrecan proteoglycan; CSPGCP; large aggregating proteoglycan; cartilage-specific proteoglycan core protein; chondroitin sulfate proteoglycan core protein 1; AGC1; SEDK; AGCAN; CSPG1; MSK16;
Gene ID 176
mRNA Refseq NM_001135
Protein Refseq NP_001126
MIM 155760
UniProt ID P16112

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACAN Products

Required fields are marked with *

My Review for All ACAN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon