Recombinant Human ACAD8 protein, T7-tagged

Cat.No. : ACAD8-211H
Product Overview : Recombinant human ACAD8 (23-415aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 23-415 a.a.
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRK AAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKF ASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFG KKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQF GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLK DYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name ACAD8 acyl-CoA dehydrogenase family, member 8 [ Homo sapiens ]
Official Symbol ACAD8
Synonyms ACAD8; acyl-Coenzyme A dehydrogenase family, member 8; ARC42; ACAD-8;
Gene ID 27034
mRNA Refseq NM_014384
Protein Refseq NP_055199
MIM 604773
UniProt ID Q9UKU7
Chromosome Location 11q25
Pathway Branched-chain amino acid catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Valine, leucine and isoleucine degradation, organism-specific biosystem; Valine, leucine and isoleucine degradation, conserved biosystem; valine degradation I, organism-specific biosystem;
Function acyl-CoA dehydrogenase activity; acyl-CoA dehydrogenase activity; flavin adenine dinucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ACAD8 Products

Required fields are marked with *

My Review for All ACAD8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon