Recombinant Human ACAD10 Protein, GST-Tagged

• Cat.No.: ACAD10-128H
• Product Overview: Human ACAD10 full-length ORF ( AAH15056.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Nov 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 52.8 kDa
• AA Sequence: MGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEGFLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGLQTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQLGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLRVGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ACAD10 acyl-CoA dehydrogenase family, member 10 [ Homo sapiens ]
• Official Symbol: ACAD10
• Synonyms: ACAD10; acyl-CoA dehydrogenase family, member 10; acyl Coenzyme A dehydrogenase family, member 10; acyl-CoA dehydrogenase family member 10; MGC5601; ACAD-10; acyl-Coenzyme A dehydrogenase family, member 10
• Gene ID: 80724
• mRNA Refseq: NM_001136538
• Protein Refseq: NP_001130010
• MIM: 611181
• UniProt ID: Q6JQN1