Recombinant Human ADAMTSL3 protein, GST-tagged

• Cat.No.: ADAMTSL3-3672H
• Product Overview: Recombinant Human ADAMTSL3 protein(616-720 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 616-720 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: TERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG
• Purity: 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ADAMTSL3 ADAMTS-like 3 [ Homo sapiens ]
• Official Symbol: ADAMTSL3
• Synonyms: ADAMTSL3; ADAMTS-like 3; ADAMTS-like protein 3; KIAA1233; punctin 2; ADAMTSL-3; punctin-2; a disintegrin-like and metalloprotease domain with thrombospondin type I motifs-like 3; MGC150716; MGC150717
• Gene ID: 57188
• mRNA Refseq: NM_207517
• Protein Refseq: NP_997400
• MIM: 609199
• UniProt ID: P82987