Recombinant Human ABLIM1
Cat.No. : | ABLIM1-26043TH |
Product Overview : | Recombinant full length Human ABLIM1 isoform 4 with a N terminal proprietary tag; Predicted MW 70.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 401 amino acids |
Description : | This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 70.180kDa inclusive of tags |
Tissue specificity : | Detected in liver, heart, skeletal muscle, brain and retina, where it is concentrated in the inner segment and in the outer plexiform layers. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILD YKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQS LGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYS RHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQ SKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAV VGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQL ILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLP GYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMP AMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDR TRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKL F |
Sequence Similarities : | Contains 1 HP (headpiece) domain.Contains 4 LIM zinc-binding domains. |
Gene Name | ABLIM1 actin binding LIM protein 1 [ Homo sapiens ] |
Official Symbol | ABLIM1 |
Synonyms | ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin; |
Gene ID | 3983 |
mRNA Refseq | NM_001003407 |
Protein Refseq | NP_001003407 |
MIM | 602330 |
Uniprot ID | O14639 |
Chromosome Location | 10q25 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function | actin binding; metal ion binding; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ABLIM1-1143M | Recombinant Mouse ABLIM1 Protein | +Inquiry |
ABLIM1-3942C | Recombinant Chicken ABLIM1 | +Inquiry |
ABLIM1-108H | Recombinant Human ABLIM1 Protein, GST-Tagged | +Inquiry |
ABLIM1-03HF | Recombinant Full Length Human ABLIM1 Protein | +Inquiry |
ABLIM1-790HF | Recombinant Full Length Human ABLIM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABLIM1-9125HCL | Recombinant Human ABLIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABLIM1 Products
Required fields are marked with *
My Review for All ABLIM1 Products
Required fields are marked with *
0
Inquiry Basket