Recombinant Human ABLIM1 Protein, GST-Tagged
Cat.No. : | ABLIM1-107H |
Product Overview : | Human ABLIM1 full-length ORF ( AAH02448.1, 1 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 72.5 kDa |
AA Sequence : | MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABLIM1 actin binding LIM protein 1 [ Homo sapiens ] |
Official Symbol | ABLIM1 |
Synonyms | ABLIM1; actin binding LIM protein 1; ABLIM, LIMAB1; actin-binding LIM protein 1; abLIM; limatin; actin-binding double-zinc-finger protein; actin-binding LIM protein family member 1; ABLIM; LIMAB1; LIMATIN; abLIM-1; MGC1224; FLJ14564; KIAA0059; DKFZp781D0148; |
Gene ID | 3983 |
mRNA Refseq | NM_001003407 |
Protein Refseq | NP_001003407 |
MIM | 602330 |
UniProt ID | O14639 |
◆ Recombinant Proteins | ||
ABLIM1-108H | Recombinant Human ABLIM1 Protein, GST-Tagged | +Inquiry |
ABLIM1-223M | Recombinant Mouse ABLIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABLIM1-1143M | Recombinant Mouse ABLIM1 Protein | +Inquiry |
ABLIM1-790HF | Recombinant Full Length Human ABLIM1 Protein, GST-tagged | +Inquiry |
ABLIM1-03HF | Recombinant Full Length Human ABLIM1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABLIM1-9125HCL | Recombinant Human ABLIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABLIM1 Products
Required fields are marked with *
My Review for All ABLIM1 Products
Required fields are marked with *
0
Inquiry Basket