Recombinant Human ABI3 Protein, GST-Tagged
Cat.No. : | ABI3-089H |
Product Overview : | Human ABI3 partial ORF ( NP_057512.1, 75 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain, and are components of the Abi/WAVE complex which regulates actin polymerization. The encoded protein inhibits ectopic metastasis of tumor cells as well as cell migration. This may be accomplished through interaction with p21-activated kinase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Molecular Mass : | 37.62 kDa |
AA Sequence : | MLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABI3 ABI family, member 3 [ Homo sapiens ] |
Official Symbol | ABI3 |
Synonyms | ABI3; ABI family, member 3; ABI gene family member 3; NESH; SSH3BP3; ABI gene family, member 3; new molecule including SH3; |
Gene ID | 51225 |
mRNA Refseq | NM_001135186 |
Protein Refseq | NP_001128658 |
MIM | 606363 |
UniProt ID | Q9P2A4 |
◆ Recombinant Proteins | ||
ABI3-756HF | Recombinant Full Length Human ABI3 Protein, GST-tagged | +Inquiry |
ABI3-675H | Recombinant Human ABI3 Protein, MYC/DDK-tagged | +Inquiry |
ABI3-088H | Recombinant Human ABI3 Protein, GST-Tagged | +Inquiry |
ABI3-089H | Recombinant Human ABI3 Protein, GST-Tagged | +Inquiry |
ABI3-483H | Recombinant Human ABI3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABI3-3HCL | Recombinant Human ABI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABI3 Products
Required fields are marked with *
My Review for All ABI3 Products
Required fields are marked with *
0
Inquiry Basket