Recombinant Human ABHD4 Protein, GST-Tagged

Cat.No. : ABHD4-078H
Product Overview : Human ABHD4 full-length ORF ( NP_071343.2, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ABHD4 (Abhydrolase Domain Containing 4) is a Protein Coding gene. Among its related pathways are Metabolism and Glycerophospholipid biosynthesis. GO annotations related to this gene include hydrolase activity and 1-alkyl-2-acetylglycerophosphocholine esterase activity. An important paralog of this gene is ABHD5.
Molecular Mass : 65.2 kDa
AA Sequence : MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABHD4 abhydrolase domain containing 4 [ Homo sapiens ]
Official Symbol ABHD4
Synonyms ABHD4; abhydrolase domain containing 4; abhydrolase domain-containing protein 4; FLJ12816; alpha/beta-hydrolase 4; lyso-N-acylphosphatidylethanolamine lipase; ABH4;
Gene ID 63874
mRNA Refseq NM_022060
Protein Refseq NP_071343
UniProt ID Q8TB40

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABHD4 Products

Required fields are marked with *

My Review for All ABHD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon