Recombinant Human ABHD4 Protein, GST-Tagged

• Cat.No.: ABHD4-078H
• Product Overview: Human ABHD4 full-length ORF ( NP_071343.2, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ABHD4 (Abhydrolase Domain Containing 4) is a Protein Coding gene. Among its related pathways are Metabolism and Glycerophospholipid biosynthesis. GO annotations related to this gene include hydrolase activity and 1-alkyl-2-acetylglycerophosphocholine esterase activity. An important paralog of this gene is ABHD5.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 65.2 kDa
• AA Sequence: MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABHD4 abhydrolase domain containing 4 [ Homo sapiens ]
• Official Symbol: ABHD4
• Synonyms: ABHD4; abhydrolase domain containing 4; abhydrolase domain-containing protein 4; FLJ12816; alpha/beta-hydrolase 4; lyso-N-acylphosphatidylethanolamine lipase; ABH4
• Gene ID: 63874
• mRNA Refseq: NM_022060
• Protein Refseq: NP_071343
• UniProt ID: Q8TB40