Recombinant Human ABHD14B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ABHD14B-1521H
• Product Overview: ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ABHD14B (Abhydrolase Domain Containing 14B) is a Protein Coding gene. Diseases associated with ABHD14B include Hypotonia-Cystinuria Syndrome. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD14A.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.3 kDa
• AA Sequence: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ABHD14B abhydrolase domain containing 14B [ Homo sapiens (human) ]
• Official Symbol: ABHD14B
• Synonyms: ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B
• Gene ID: 84836
• mRNA Refseq: NM_032750
• Protein Refseq: NP_116139
• UniProt ID: Q96IU4